| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families) ![]() automatically mapped to Pfam PF00875 |
| Family c.28.1.1: Cryptochrome/photolyase, N-terminal domain [52426] (3 proteins) |
| Protein DNA photolyase [52427] (3 species) binds a light-harvesting cofactor |
| Species Synechococcus elongatus [TaxId:32046] [52429] (7 PDB entries) Uniprot P05327 1-474 cofactor is HDF |
| Domain d1tezb2: 1tez B:2-204 [112412] Other proteins in same PDB: d1teza1, d1tezb1, d1tezc1, d1tezd1 protein/DNA complex; complexed with fad, hdf, mg, tcp |
PDB Entry: 1tez (more details), 1.8 Å
SCOPe Domain Sequences for d1tezb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tezb2 c.28.1.1 (B:2-204) DNA photolyase {Synechococcus elongatus [TaxId: 32046]}
aapilfwhrrdlrlsdniglaaaraqsaqliglfcldpqilqsadmaparvaylqgclqe
lqqryqqagsrllllqgdpqhlipqlaqqlqaeavywnqdiepygrdrdgqvaaalktag
iravqlwdqllhspdqilsgsgnpysvygpfwknwqaqpkptpvatptelvdlspeqlta
iaplllselptlkqlgfdwdggf
Timeline for d1tezb2: