Lineage for d1teza1 (1tez A:205-475)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 541571Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
  4. 541572Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (1 family) (S)
  5. 541573Family a.99.1.1: Cryptochrome/photolyase FAD-binding domain [48174] (2 proteins)
  6. 541574Protein C-terminal domain of DNA photolyase [48175] (3 species)
    N-terminal domain is alpha/beta and binds a light-harvesting cofactor
  7. 541575Species Anacystis nidulans [48177] (7 PDB entries)
  8. 541577Domain d1teza1: 1tez A:205-475 [112409]
    Other proteins in same PDB: d1teza2, d1tezb2, d1tezc2, d1tezd2

Details for d1teza1

PDB Entry: 1tez (more details), 1.8 Å

PDB Description: complex between dna and the dna photolyase from anacystis nidulans

SCOP Domain Sequences for d1teza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1teza1 a.99.1.1 (A:205-475) C-terminal domain of DNA photolyase {Anacystis nidulans}
pvepgetaaiarlqefcdraiadydpqrnfpaeagtsglspalkfgaigirqawqaasaa
halsrsdearnsirvwqqelawrefyqhalyhfpsladgpyrslwqqfpwenrealftaw
tqaqtgypivdaamrqltetgwmhnrcrmivasfltkdliidwrrgeqffmqhlvdgdla
annggwqwsassgmdpkplrifnpasqakkfdatatyikrwlpelrhvhpkdlisgeitp
ierrgypapivnhnlrqkqfkalynqlkaai

SCOP Domain Coordinates for d1teza1:

Click to download the PDB-style file with coordinates for d1teza1.
(The format of our PDB-style files is described here.)

Timeline for d1teza1: