![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) ![]() C-terminal domain is beta/alpha barrel |
![]() | Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
![]() | Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species) |
![]() | Species Chlorobium tepidum [TaxId:1097] [117975] (2 PDB entries) Uniprot Q8KBL4 1-428 |
![]() | Domain d1telb2: 1tel B:2001-2145 [112408] Other proteins in same PDB: d1tela1, d1telb1 |
PDB Entry: 1tel (more details), 2.7 Å
SCOPe Domain Sequences for d1telb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1telb2 d.58.9.1 (B:2001-2145) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]} mnaedvkgffasresldmeqylvldyylesvgdietalahfcseqstaqwkrvgvdedfr lvhaakvidyevieeleqlsypvkhsetgkihacrvtiahphcnfgpkipnlltavcgeg tyftpgvpvvklmdihfpdtyladf
Timeline for d1telb2: