SCOP 1.71: Domain d1telb2: 1tel B:2001-2145

Lineage for d1telb2 (1tel B:2001-2145)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (10 species)

7. Species Chlorobium tepidum [TaxId:1097] [117975] (1 PDB entry)

8. Domain d1telb2: 1tel B:2001-2145 [112408]
   Other proteins in same PDB: d1tela1, d1telb1

Details for d1telb2

PDB Entry: 1tel, 2.7 Å

PDB Description: crystal structure of a rubisco-like protein from chlorobium tepidum

SCOP Domain Sequences for d1telb2:

Sequence; same for both SEQRES and ATOM records:

>d1telb2 d.58.9.1 (B:2001-2145) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum}
mnaedvkgffasresldmeqylvldyylesvgdietalahfcseqstaqwkrvgvdedfr
lvhaakvidyevieeleqlsypvkhsetgkihacrvtiahphcnfgpkipnlltavcgeg
tyftpgvpvvklmdihfpdtyladf

Timeline for d1telb2:

• d1telb2 is new in SCOP 1.71
  
• d1telb2 appears in SCOP 1.73
  
• d1telb2 appears in the current release, SCOPe 2.08