Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) automatically mapped to Pfam PF00016 |
Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins) N-terminal domain is alpha+beta |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (14 species) |
Species Chlorobium tepidum [TaxId:1097] [117389] (2 PDB entries) Uniprot Q8KBL4 1-428 |
Domain d1telb1: 1tel B:2146-2428 [112407] Other proteins in same PDB: d1tela2, d1telb2 |
PDB Entry: 1tel (more details), 2.7 Å
SCOPe Domain Sequences for d1telb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1telb1 c.1.14.1 (B:2146-2428) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]} egpkfgieglrdilnahgrpiffgvvkpniglspgefaeiayqswlggldiakddemlad vtwssieeraahlgkarrkaeaetgepkiylanitdevdslmekhdvavrnganallina lpvglsavrmlsnytqvplighfpfiasfsrmekygihskvmtklqrlagldavimpgfg drmmtpeeevlenviectkpmgrikpclpvpggsdsaltlqtvyekvgnvdfgfvpgrgv fghpmgpkagaksirqaweaieqgisietwaethpelqamvdq
Timeline for d1telb1: