SCOPe 2.01: Domain d1telb1: 1tel B:2146-2428

Lineage for d1telb1 (1tel B:2146-2428)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family)

5. Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
   N-terminal domain is alpha+beta

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (12 species)

7. Species Chlorobium tepidum [TaxId:1097] [117389] (2 PDB entries)
   Uniprot Q8KBL4 1-428

8. Domain d1telb1: 1tel B:2146-2428 [112407]
   Other proteins in same PDB: d1tela2, d1telb2

Details for d1telb1

PDB Entry: 1tel, 2.7 Å

PDB Description: crystal structure of a rubisco-like protein from chlorobium tepidum

PDB Compounds: (B:) ribulose bisphosphate carboxylase, large subunit

SCOPe Domain Sequences for d1telb1:

Sequence; same for both SEQRES and ATOM records:

>d1telb1 c.1.14.1 (B:2146-2428) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]}
egpkfgieglrdilnahgrpiffgvvkpniglspgefaeiayqswlggldiakddemlad
vtwssieeraahlgkarrkaeaetgepkiylanitdevdslmekhdvavrnganallina
lpvglsavrmlsnytqvplighfpfiasfsrmekygihskvmtklqrlagldavimpgfg
drmmtpeeevlenviectkpmgrikpclpvpggsdsaltlqtvyekvgnvdfgfvpgrgv
fghpmgpkagaksirqaweaieqgisietwaethpelqamvdq

Timeline for d1telb1:

• d1telb1 first appeared in SCOP 1.71
  
• d1telb1 appears in SCOP 1.75
  
• d1telb1 appears in SCOPe 2.02
  
• d1telb1 appears in the current release, SCOPe 2.08