SCOP 1.75: Domain d1tela2: 1tel A:1001-1145

Lineage for d1tela2 (1tel A:1001-1145)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)

7. Species Chlorobium tepidum [TaxId:1097] [117975] (2 PDB entries)
   Uniprot Q8KBL4 1-428

8. Domain d1tela2: 1tel A:1001-1145 [112406]
   Other proteins in same PDB: d1tela1, d1telb1

Details for d1tela2

PDB Entry: 1tel, 2.7 Å

PDB Description: crystal structure of a rubisco-like protein from chlorobium tepidum

PDB Compounds: (A:) ribulose bisphosphate carboxylase, large subunit

SCOP Domain Sequences for d1tela2:

Sequence, based on SEQRES records:

>d1tela2 d.58.9.1 (A:1001-1145) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]}
mnaedvkgffasresldmeqylvldyylesvgdietalahfcseqstaqwkrvgvdedfr
lvhaakvidyevieeleqlsypvkhsetgkihacrvtiahphcnfgpkipnlltavcgeg
tyftpgvpvvklmdihfpdtyladf

Sequence, based on observed residues (ATOM records):

>d1tela2 d.58.9.1 (A:1001-1145) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]}
mnaedvkgffasresldmeqylvldyylesvgdietalahfcseqstaqwkrvgvdedfr
lvhaakvidyevieeleqlsypvkgkihacrvtiahphcnfgpkipnlltavcgegtyft
pgvpvvklmdihfpdtyladf

Timeline for d1tela2:

• d1tela2 first appeared in SCOP 1.71
  
• d1tela2 appears in SCOP 1.73
  
• d1tela2 appears in SCOPe 2.01
  
• d1tela2 appears in the current release, SCOPe 2.08