Lineage for d1tela1 (1tel A:1146-1428)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 573365Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 573366Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
    N-terminal domain is alpha+beta
  6. 573367Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (10 species)
  7. 573400Species Chlorobium tepidum [TaxId:1097] [117389] (1 PDB entry)
  8. 573401Domain d1tela1: 1tel A:1146-1428 [112405]
    Other proteins in same PDB: d1tela2, d1telb2

Details for d1tela1

PDB Entry: 1tel (more details), 2.7 Å

PDB Description: crystal structure of a rubisco-like protein from chlorobium tepidum

SCOP Domain Sequences for d1tela1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tela1 c.1.14.1 (A:1146-1428) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum}
egpkfgieglrdilnahgrpiffgvvkpniglspgefaeiayqswlggldiakddemlad
vtwssieeraahlgkarrkaeaetgepkiylanitdevdslmekhdvavrnganallina
lpvglsavrmlsnytqvplighfpfiasfsrmekygihskvmtklqrlagldavimpgfg
drmmtpeeevlenviectkpmgrikpclpvpggsdsaltlqtvyekvgnvdfgfvpgrgv
fghpmgpkagaksirqaweaieqgisietwaethpelqamvdq

SCOP Domain Coordinates for d1tela1:

Click to download the PDB-style file with coordinates for d1tela1.
(The format of our PDB-style files is described here.)

Timeline for d1tela1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tela2