SCOPe 2.07: Domain d1te7a_: 1te7 A:

Lineage for d1te7a_ (1te7 A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (14 families)

5. Family b.122.1.7: yqfB-like [117356] (1 protein)
   Pfam PF06164; DUF978

6. Protein Hypothetical protein YqfB [117357] (1 species)

7. Species Escherichia coli [TaxId:562] [117358] (1 PDB entry)
   Uniprot P67603

8. Domain d1te7a_: 1te7 A: [112404]
   Structural genomics target

Details for d1te7a_

PDB Entry: 1te7

PDB Description: solution nmr structure of protein yqfb from escherichia coli. northeast structural genomics consortium target et99

PDB Compounds: (A:) Hypothetical UPF0267 protein yqfB

SCOPe Domain Sequences for d1te7a_:

Sequence; same for both SEQRES and ATOM records:

>d1te7a_ b.122.1.7 (A:) Hypothetical protein YqfB {Escherichia coli [TaxId: 562]}
mqpnditffqrfqddilagrktitirdeseshfktgdvlrvgrfeddgyfctievtatst
vtldtltekhaeqenmtltelkkviadiypgqtqfyviefkcl

Timeline for d1te7a_:

• d1te7a_ first appeared in SCOP 1.71
  
• d1te7a_ appears in SCOPe 2.06
  
• d1te7a_ appears in the current release, SCOPe 2.08