Lineage for d1te7a_ (1te7 A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 680324Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 680325Superfamily b.122.1: PUA domain-like [88697] (10 families) (S)
  5. 680443Family b.122.1.7: yqfB-like [117356] (1 protein)
    Pfam PF06164; DUF978
  6. 680444Protein Hypothetical protein YqfB [117357] (1 species)
  7. 680445Species Escherichia coli [TaxId:562] [117358] (1 PDB entry)
  8. 680446Domain d1te7a_: 1te7 A: [112404]
    Structural genomics target

Details for d1te7a_

PDB Entry: 1te7 (more details)

PDB Description: solution nmr structure of protein yqfb from escherichia coli. northeast structural genomics consortium target et99
PDB Compounds: (A:) Hypothetical UPF0267 protein yqfB

SCOP Domain Sequences for d1te7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1te7a_ b.122.1.7 (A:) Hypothetical protein YqfB {Escherichia coli [TaxId: 562]}
mqpnditffqrfqddilagrktitirdeseshfktgdvlrvgrfeddgyfctievtatst
vtldtltekhaeqenmtltelkkviadiypgqtqfyviefkcl

SCOP Domain Coordinates for d1te7a_:

Click to download the PDB-style file with coordinates for d1te7a_.
(The format of our PDB-style files is described here.)

Timeline for d1te7a_: