Class b: All beta proteins [48724] (180 folds) |
Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
Superfamily b.122.1: PUA domain-like [88697] (15 families) |
Family b.122.1.7: yqfB-like [117356] (1 protein) Pfam PF06164; DUF978 |
Protein Hypothetical protein YqfB [117357] (1 species) |
Species Escherichia coli [TaxId:562] [117358] (1 PDB entry) Uniprot P67603 |
Domain d1te7a_: 1te7 A: [112404] Structural genomics target |
PDB Entry: 1te7 (more details)
SCOPe Domain Sequences for d1te7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1te7a_ b.122.1.7 (A:) Hypothetical protein YqfB {Escherichia coli [TaxId: 562]} mqpnditffqrfqddilagrktitirdeseshfktgdvlrvgrfeddgyfctievtatst vtldtltekhaeqenmtltelkkviadiypgqtqfyviefkcl
Timeline for d1te7a_: