Class b: All beta proteins [48724] (178 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins) |
Protein Stress sensor protease DegS, catalytic domain [110236] (1 species) |
Species Escherichia coli [TaxId:562] [110237] (12 PDB entries) Uniprot P31137 37-354 ! Uniprot P31137 |
Domain d1te0a2: 1te0 A:37-254 [112401] Other proteins in same PDB: d1te0a1, d1te0b1 |
PDB Entry: 1te0 (more details), 2.2 Å
SCOPe Domain Sequences for d1te0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1te0a2 b.47.1.1 (A:37-254) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} fdstdetpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkh vindadqiivalqdgrvfeallvgsdsltdlavliikatgglptipinarrvphigdvvl aignpynlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgin tlsfdksndgetpegigfaipfqlatkimdklirdgrv
Timeline for d1te0a2: