SCOPe 2.07: Domain d1te0a2: 1te0 A:37-254

Lineage for d1te0a2 (1te0 A:37-254)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)

6. Protein Stress sensor protease DegS, catalytic domain [110236] (1 species)

7. Species Escherichia coli [TaxId:562] [110237] (12 PDB entries)
   Uniprot P31137 37-354 ! Uniprot P31137

8. Domain d1te0a2: 1te0 A:37-254 [112401]
   Other proteins in same PDB: d1te0a1, d1te0b1

Details for d1te0a2

PDB Entry: 1te0, 2.2 Å

PDB Description: Structural analysis of DegS, a stress sensor of the bacterial periplasm

PDB Compounds: (A:) Protease degS

SCOPe Domain Sequences for d1te0a2:

Sequence; same for both SEQRES and ATOM records:

>d1te0a2 b.47.1.1 (A:37-254) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]}
fdstdetpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkh
vindadqiivalqdgrvfeallvgsdsltdlavliikatgglptipinarrvphigdvvl
aignpynlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgin
tlsfdksndgetpegigfaipfqlatkimdklirdgrv

Timeline for d1te0a2:

• d1te0a2 first appeared in SCOP 1.71
  
• d1te0a2 appears in SCOPe 2.06
  
• d1te0a2 appears in the current release, SCOPe 2.08