Lineage for d1te0a1 (1te0 A:255-354)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2786418Family b.36.1.4: HtrA-like serine proteases [74933] (4 proteins)
  6. 2786462Protein Stress sensor protease DegS, C-terminal domain [110188] (1 species)
  7. 2786463Species Escherichia coli [TaxId:562] [110189] (6 PDB entries)
    Uniprot P31137 37-354 ! Uniprot P31137
  8. 2786470Domain d1te0a1: 1te0 A:255-354 [112400]
    Other proteins in same PDB: d1te0a2, d1te0b2

Details for d1te0a1

PDB Entry: 1te0 (more details), 2.2 Å

PDB Description: Structural analysis of DegS, a stress sensor of the bacterial periplasm
PDB Compounds: (A:) Protease degS

SCOPe Domain Sequences for d1te0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1te0a1 b.36.1.4 (A:255-354) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]}
irgyigiggreiaplhaqgggidqlqgivvnevspdgpaanagiqvndliisvdnkpais
aletmdqvaeirpgsvipvvvmrddkqltlqvtiqeypat

SCOPe Domain Coordinates for d1te0a1:

Click to download the PDB-style file with coordinates for d1te0a1.
(The format of our PDB-style files is described here.)

Timeline for d1te0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1te0a2