Lineage for d1tdwa_ (1tdw A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2610723Fold d.178: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56533] (1 superfamily)
    unusual fold
  4. 2610724Superfamily d.178.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56534] (1 family) (S)
  5. 2610725Family d.178.1.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56535] (4 proteins)
  6. 2610726Protein Phenylalanine hydroxylase, PAH [56538] (3 species)
  7. 2610741Species Human (Homo sapiens) [TaxId:9606] [56539] (15 PDB entries)
    Uniprot P00439 117-424
  8. 2610754Domain d1tdwa_: 1tdw A: [112399]
    complexed with fe; mutant

Details for d1tdwa_

PDB Entry: 1tdw (more details), 2.1 Å

PDB Description: crystal structure of double truncated human phenylalanine hydroxylase bh4-responsive pku mutant a313t.
PDB Compounds: (A:) phenylalanine-4-hydroxylase

SCOPe Domain Sequences for d1tdwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tdwa_ d.178.1.1 (A:) Phenylalanine hydroxylase, PAH {Human (Homo sapiens) [TaxId: 9606]}
tvpwfprtiqeldrfanqilsygaeldadhpgfkdpvyrarrkqfadiaynyrhgqpipr
veymeeekktwgtvfktlkslykthacyeynhifpllekycgfhednipqledvsqflqt
ctgfrlrpvagllssrdflgglafrvfhctqyirhgskpmytpepdichellghvplfsd
rsfaqfsqeiglaslgtpdeyieklatiywftvefglckqgdsikaygagllssfgelqy
clsekpkllplelektaiqnytvtefqplyyvaesfndakekvrnfaatiprpfsvrydp
ytqrievl

SCOPe Domain Coordinates for d1tdwa_:

Click to download the PDB-style file with coordinates for d1tdwa_.
(The format of our PDB-style files is described here.)

Timeline for d1tdwa_: