Lineage for d1tdwa_ (1tdw A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 738939Fold d.178: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56533] (1 superfamily)
    unusual fold
  4. 738940Superfamily d.178.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56534] (1 family) (S)
  5. 738941Family d.178.1.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56535] (3 proteins)
  6. 738942Protein Phenylalanine hydroxylase, PAH [56538] (3 species)
  7. 738947Species Human (Homo sapiens) [TaxId:9606] [56539] (15 PDB entries)
  8. 738959Domain d1tdwa_: 1tdw A: [112399]
    complexed with fe; mutant

Details for d1tdwa_

PDB Entry: 1tdw (more details), 2.1 Å

PDB Description: crystal structure of double truncated human phenylalanine hydroxylase bh4-responsive pku mutant a313t.
PDB Compounds: (A:) phenylalanine-4-hydroxylase

SCOP Domain Sequences for d1tdwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tdwa_ d.178.1.1 (A:) Phenylalanine hydroxylase, PAH {Human (Homo sapiens) [TaxId: 9606]}
tvpwfprtiqeldrfanqilsygaeldadhpgfkdpvyrarrkqfadiaynyrhgqpipr
veymeeekktwgtvfktlkslykthacyeynhifpllekycgfhednipqledvsqflqt
ctgfrlrpvagllssrdflgglafrvfhctqyirhgskpmytpepdichellghvplfsd
rsfaqfsqeiglaslgtpdeyieklatiywftvefglckqgdsikaygagllssfgelqy
clsekpkllplelektaiqnytvtefqplyyvaesfndakekvrnfaatiprpfsvrydp
ytqrievl

SCOP Domain Coordinates for d1tdwa_:

Click to download the PDB-style file with coordinates for d1tdwa_.
(The format of our PDB-style files is described here.)

Timeline for d1tdwa_: