Lineage for d1tdwa_ (1tdw A:)
- Root: SCOP 1.71
Class d: Alpha and beta proteins (a+b) [53931] (286 folds) 
Fold d.178: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56533] (1 superfamily)
unusual foldSuperfamily d.178.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56534] (1 family) 
Family d.178.1.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56535] (3 proteins) Protein Phenylalanine hydroxylase, PAH [56538] (3 species) 
Species Human (Homo sapiens) [TaxId:9606] [56539] (15 PDB entries) 
Domain d1tdwa_: 1tdw A: [112399]
complexed with fe; mutant
Details for d1tdwa_
PDB Entry: 1tdw (more details), 2.1 Å
PDB Description: crystal structure of double truncated human phenylalanine hydroxylase bh4-responsive pku mutant a313t.
SCOP Domain Sequences for d1tdwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tdwa_ d.178.1.1 (A:) Phenylalanine hydroxylase, PAH {Human (Homo sapiens)}
tvpwfprtiqeldrfanqilsygaeldadhpgfkdpvyrarrkqfadiaynyrhgqpipr
veymeeekktwgtvfktlkslykthacyeynhifpllekycgfhednipqledvsqflqt
ctgfrlrpvagllssrdflgglafrvfhctqyirhgskpmytpepdichellghvplfsd
rsfaqfsqeiglaslgtpdeyieklatiywftvefglckqgdsikaygagllssfgelqy
clsekpkllplelektaiqnytvtefqplyyvaesfndakekvrnfaatiprpfsvrydp
ytqrievl
SCOP Domain Coordinates for d1tdwa_:
Click to download the PDB-style file with coordinates for d1tdwa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tdwa_:
- d1tdwa_ is new in SCOP 1.71
- d1tdwa_ appears in SCOP 1.73
- d1tdwa_ appears in the current release, SCOPe 2.08
View in 3D