Lineage for d1tdga_ (1tdg A:)

  1. Root: SCOP 1.71
  2. 617324Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds)
  3. 617469Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 617470Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (2 families) (S)
  5. 617471Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (13 proteins)
  6. 617555Protein beta-Lactamase, class A [56606] (15 species)
  7. 617607Species Klebsiella pneumoniae, SHV-1 [TaxId:573] [56609] (7 PDB entries)
    inhibited by tazobactam
  8. 617610Domain d1tdga_: 1tdg A: [112397]
    complexed with ma4, mdd, mpd, tbe; mutant

Details for d1tdga_

PDB Entry: 1tdg (more details), 1.8 Å

PDB Description: complex of s130g shv-1 beta-lactamase with tazobactam

SCOP Domain Sequences for d1tdga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tdga_ e.3.1.1 (A:) beta-Lactamase, class A {Klebsiella pneumoniae, SHV-1}
spqpleqiklsesqlsgrvgmiemdlasgrtltawraderfpmmstfkvvlcgavlarvd
agdeqlerkihyrqqdlvdyspvsekhladgmtvgelcaaaitmgdnsaanlllatvggp
agltaflrqigdnvtrldrwetelnealpgdardtttpasmaatlrklltsqrlsarsqr
qllqwmvddrvagplirsvlpagwfiadktgagergargivallgpnnkaerivviylrd
tpasmaernqqiagigaaliehwqr

SCOP Domain Coordinates for d1tdga_:

Click to download the PDB-style file with coordinates for d1tdga_.
(The format of our PDB-style files is described here.)

Timeline for d1tdga_: