SCOP 1.75: Domain d1td9f_: 1td9 F:

Lineage for d1td9f_ (1td9 F:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (5 families)
   the constituent families form similar dimers

5. Family c.77.1.5: Phosphotransacetylase [102663] (2 proteins)
   Pfam PF01515; contains extra beta-alpha unit between strands 2 and 3; closer relationships to the PdxA-like and PlsX-like families

6. Protein Phosphotransacetylase Pta [110717] (3 species)

7. Species Bacillus subtilis [TaxId:1423] [117726] (2 PDB entries)
   Uniprot P39646

8. Domain d1td9f_: 1td9 F: [112396]
   Structural genomics target
   complexed with so4

Details for d1td9f_

PDB Entry: 1td9, 2.75 Å

PDB Description: crystal structure of a phosphotransacetylase from bacillus subtilis

PDB Compounds: (F:) Phosphate acetyltransferase

SCOP Domain Sequences for d1td9f_:

Sequence; same for both SEQRES and ATOM records:

>d1td9f_ c.77.1.5 (F:) Phosphotransacetylase Pta {Bacillus subtilis [TaxId: 1423]}
madlfstvqekvagkdvkivfpeglderileavsklagnkvlnpivigneneiqakakel
nltlggvkiydphtyegmedlvqafverrkgkateeqarkalldenyfgtmlvykgladg
lvsgaahstadtvrpalqiiktkegvkktsgvfimargeeqyvfadcainiapdsqdlae
iaiesantakmfdieprvamlsfstkgsaksdetekvadavkiakekapeltldgefqfd
aafvpsvaekkapdseikgdanvfvfpsleagnigykiaqrlgnfeavgpilqglnmpvn
dlsrgcnaedvynlalitaaqal

Timeline for d1td9f_:

• d1td9f_ first appeared in SCOP 1.71
  
• d1td9f_ appears in SCOP 1.73
  
• d1td9f_ appears in SCOPe 2.01
  
• d1td9f_ appears in the current release, SCOPe 2.08