![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
![]() | Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (5 families) ![]() the constituent families form similar dimers |
![]() | Family c.77.1.5: Phosphotransacetylase [102663] (2 proteins) Pfam PF01515; contains extra beta-alpha unit between strands 2 and 3; closer relationships to the PdxA-like and PlsX-like families |
![]() | Protein Phosphotransacetylase Pta [110717] (3 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [117726] (2 PDB entries) Uniprot P39646 |
![]() | Domain d1td9e_: 1td9 E: [112395] Structural genomics target |
PDB Entry: 1td9 (more details), 2.75 Å
SCOP Domain Sequences for d1td9e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1td9e_ c.77.1.5 (E:) Phosphotransacetylase Pta {Bacillus subtilis [TaxId: 1423]} madlfstvqekvagkdvkivfpeglderileavsklagnkvlnpivigneneiqakakel nltlggvkiydphtyegmedlvqafverrkgkateeqarkalldenyfgtmlvykgladg lvsgaahstadtvrpalqiiktkegvkktsgvfimargeeqyvfadcainiapdsqdlae iaiesantakmfdieprvamlsfstkgsaksdetekvadavkiakekapeltldgefqfd aafvpsvaekkapdseikgdanvfvfpsleagnigykiaqrlgnfeavgpilqglnmpvn dlsrgcnaedvynlalitaaqal
Timeline for d1td9e_: