Lineage for d1td9e_ (1td9 E:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 843892Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 843893Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (5 families) (S)
    the constituent families form similar dimers
  5. 844025Family c.77.1.5: Phosphotransacetylase [102663] (2 proteins)
    Pfam PF01515; contains extra beta-alpha unit between strands 2 and 3; closer relationships to the PdxA-like and PlsX-like families
  6. 844029Protein Phosphotransacetylase Pta [110717] (3 species)
  7. 844030Species Bacillus subtilis [TaxId:1423] [117726] (2 PDB entries)
    Uniprot P39646
  8. 844041Domain d1td9e_: 1td9 E: [112395]
    Structural genomics target

Details for d1td9e_

PDB Entry: 1td9 (more details), 2.75 Å

PDB Description: crystal structure of a phosphotransacetylase from bacillus subtilis
PDB Compounds: (E:) Phosphate acetyltransferase

SCOP Domain Sequences for d1td9e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1td9e_ c.77.1.5 (E:) Phosphotransacetylase Pta {Bacillus subtilis [TaxId: 1423]}
madlfstvqekvagkdvkivfpeglderileavsklagnkvlnpivigneneiqakakel
nltlggvkiydphtyegmedlvqafverrkgkateeqarkalldenyfgtmlvykgladg
lvsgaahstadtvrpalqiiktkegvkktsgvfimargeeqyvfadcainiapdsqdlae
iaiesantakmfdieprvamlsfstkgsaksdetekvadavkiakekapeltldgefqfd
aafvpsvaekkapdseikgdanvfvfpsleagnigykiaqrlgnfeavgpilqglnmpvn
dlsrgcnaedvynlalitaaqal

SCOP Domain Coordinates for d1td9e_:

Click to download the PDB-style file with coordinates for d1td9e_.
(The format of our PDB-style files is described here.)

Timeline for d1td9e_: