Lineage for d1td9b_ (1td9 B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 591543Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 591544Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (5 families) (S)
    the constituent families form similar dimers
  5. 591670Family c.77.1.5: Phosphotransacetylase [102663] (2 proteins)
    Pfam 01515; contains extra beta-alpha unit between strands 2 and 3; closer relationships to the PdxA-like and PlsX-like families
  6. 591674Protein Phosphotransacetylase Pta [110717] (3 species)
  7. 591675Species Bacillus subtilis [TaxId:1423] [117726] (2 PDB entries)
  8. 591683Domain d1td9b_: 1td9 B: [112392]

Details for d1td9b_

PDB Entry: 1td9 (more details), 2.75 Å

PDB Description: crystal structure of a phosphotransacetylase from bacillus subtilis

SCOP Domain Sequences for d1td9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1td9b_ c.77.1.5 (B:) Phosphotransacetylase Pta {Bacillus subtilis}
gmadlfstvqekvagkdvkivfpeglderileavsklagnkvlnpivigneneiqakake
lnltlggvkiydphtyegmedlvqafverrkgkateeqarkalldenyfgtmlvykglad
glvsgaahstadtvrpalqiiktkegvkktsgvfimargeeqyvfadcainiapdsqdla
eiaiesantakmfdieprvamlsfstkgsaksdetekvadavkiakekapeltldgefqf
daafvpsvaekkapdseikgdanvfvfpsleagnigykiaqrlgnfeavgpilqglnmpv
ndlsrgcnaedvynlalitaaqal

SCOP Domain Coordinates for d1td9b_:

Click to download the PDB-style file with coordinates for d1td9b_.
(The format of our PDB-style files is described here.)

Timeline for d1td9b_: