Lineage for d1td9a_ (1td9 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1005388Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 1005389Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 1005588Family c.77.1.5: Phosphotransacetylase [102663] (2 proteins)
    Pfam PF01515; contains extra beta-alpha unit between strands 2 and 3; closer relationships to the PdxA-like and PlsX-like families
  6. 1005592Protein Phosphotransacetylase Pta [110717] (3 species)
  7. 1005593Species Bacillus subtilis [TaxId:1423] [117726] (2 PDB entries)
    Uniprot P39646
  8. 1005600Domain d1td9a_: 1td9 A: [112391]
    Structural genomics target
    complexed with so4

Details for d1td9a_

PDB Entry: 1td9 (more details), 2.75 Å

PDB Description: crystal structure of a phosphotransacetylase from bacillus subtilis
PDB Compounds: (A:) Phosphate acetyltransferase

SCOPe Domain Sequences for d1td9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1td9a_ c.77.1.5 (A:) Phosphotransacetylase Pta {Bacillus subtilis [TaxId: 1423]}
madlfstvqekvagkdvkivfpeglderileavsklagnkvlnpivigneneiqakakel
nltlggvkiydphtyegmedlvqafverrkgkateeqarkalldenyfgtmlvykgladg
lvsgaahstadtvrpalqiiktkegvkktsgvfimargeeqyvfadcainiapdsqdlae
iaiesantakmfdieprvamlsfstkgsaksdetekvadavkiakekapeltldgefqfd
aafvpsvaekkapdseikgdanvfvfpsleagnigykiaqrlgnfeavgpilqglnmpvn
dlsrgcnaedvynlalitaaqal

SCOPe Domain Coordinates for d1td9a_:

Click to download the PDB-style file with coordinates for d1td9a_.
(The format of our PDB-style files is described here.)

Timeline for d1td9a_: