Lineage for d1td6a_ (1td6 A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 546372Fold a.234: Hypothetical protein MPN330 [116964] (1 superfamily)
    multihelical; consists of three different 4-helical bundles
  4. 546373Superfamily a.234.1: Hypothetical protein MPN330 [116965] (1 family) (S)
  5. 546374Family a.234.1.1: Hypothetical protein MPN330 [116966] (1 protein)
  6. 546375Protein Hypothetical protein MPN330 [116967] (1 species)
  7. 546376Species Mycoplasma pneumoniae [TaxId:2104] [116968] (1 PDB entry)
  8. 546377Domain d1td6a_: 1td6 A: [112390]
    Structural genomics target

Details for d1td6a_

PDB Entry: 1td6 (more details), 2.5 Å

PDB Description: Crystal structure of the conserved hypothetical protein MP506/MPN330 (gi: 1674200)from Mycoplasma pneumoniae

SCOP Domain Sequences for d1td6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1td6a_ a.234.1.1 (A:) Hypothetical protein MPN330 {Mycoplasma pneumoniae}
pnqfvnhlsalkkhfasykelreafndyhkhngdelttfflhqfdkvmelvkqkdfktaq
srceeelaapylpkplvsffqsllqlvnhdlleqqnaalaslpaakiielvlqdypnkln
mihyllpktkafvkphllqrlqfvltdsellelkrfsffqalnqipgfqgeqveyfnskl
kqkftltlgefeiaqqpdakayfeqlitqiqqlflkepvnaefaneiidaflvsyfplhp
pvplaqlaakiyeyvsqivlneavnlkdeliklivhtlyeqldrpv

SCOP Domain Coordinates for d1td6a_:

Click to download the PDB-style file with coordinates for d1td6a_.
(The format of our PDB-style files is described here.)

Timeline for d1td6a_: