Lineage for d1td4a_ (1td4 A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 678386Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 678438Superfamily b.85.2: Head decoration protein D (gpD, major capsid protein D) [51274] (1 family) (S)
  5. 678439Family b.85.2.1: Head decoration protein D (gpD, major capsid protein D) [51275] (1 protein)
  6. 678440Protein Head decoration protein D (gpD, major capsid protein D) [51276] (2 species)
  7. 678452Species Bacteriophage P21 [TaxId:10711] [117332] (3 PDB entries)
  8. 678453Domain d1td4a_: 1td4 A: [112389]

Details for d1td4a_

PDB Entry: 1td4 (more details), 1.5 Å

PDB Description: crystal structure of vshp_bpp21 in space group h3 with high resolution.
PDB Compounds: (A:) Head decoration protein

SCOP Domain Sequences for d1td4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1td4a_ b.85.2.1 (A:) Head decoration protein D (gpD, major capsid protein D) {Bacteriophage P21 [TaxId: 10711]}
vrifagndpahtatgssgissptpaltplmldeatgklvvwdgqkagsavgilvlplegt
etaltyyksgtfateaihwpesvdehkkanafagsalshaalp

SCOP Domain Coordinates for d1td4a_:

Click to download the PDB-style file with coordinates for d1td4a_.
(The format of our PDB-style files is described here.)

Timeline for d1td4a_: