SCOPe 2.04: Domain d1td3b_: 1td3 B:

Lineage for d1td3b_ (1td3 B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.2: Head decoration protein D (gpD, major capsid protein D) [51274] (1 family)
   automatically mapped to Pfam PF02924

5. Family b.85.2.1: Head decoration protein D (gpD, major capsid protein D) [51275] (2 proteins)

6. Protein Head decoration protein D (gpD, major capsid protein D) [51276] (2 species)

7. Species Bacteriophage P21 [TaxId:10711] [117332] (3 PDB entries)
   Uniprot P36275

8. Domain d1td3b_: 1td3 B: [112387]

Details for d1td3b_

PDB Entry: 1td3, 2.37 Å

PDB Description: crystal structure of vshp_bpp21 in space group c2

PDB Compounds: (B:) Head decoration protein

SCOPe Domain Sequences for d1td3b_:

Sequence; same for both SEQRES and ATOM records:

>d1td3b_ b.85.2.1 (B:) Head decoration protein D (gpD, major capsid protein D) {Bacteriophage P21 [TaxId: 10711]}
vrifagndpahtatgssgissptpaltplmldeatgklvvwdgqkagsavgilvlplegt
etaltyyksgtfateaihwpesvdehkkanafagsalshaalp

Timeline for d1td3b_:

• d1td3b_ first appeared in SCOP 1.71
  
• d1td3b_ appears in SCOPe 2.03
  
• d1td3b_ appears in SCOPe 2.05
  
• d1td3b_ appears in the current release, SCOPe 2.08