![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
![]() | Superfamily b.85.2: Head decoration protein D (gpD, major capsid protein D) [51274] (1 family) ![]() |
![]() | Family b.85.2.1: Head decoration protein D (gpD, major capsid protein D) [51275] (1 protein) |
![]() | Protein Head decoration protein D (gpD, major capsid protein D) [51276] (2 species) |
![]() | Species Bacteriophage P21 [TaxId:10711] [117332] (3 PDB entries) Uniprot P36275 |
![]() | Domain d1td0c_: 1td0 C: [112384] |
PDB Entry: 1td0 (more details), 1.95 Å
SCOPe Domain Sequences for d1td0c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1td0c_ b.85.2.1 (C:) Head decoration protein D (gpD, major capsid protein D) {Bacteriophage P21 [TaxId: 10711]} vrifagndpahtatgssgissptpaltplmldeatgklvvwdgqkagsavgilvlplegt etaltyyksgtfateaihwpesvdehkkanafagsalshaa
Timeline for d1td0c_: