Lineage for d1td0b_ (1td0 B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1560503Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1560574Superfamily b.85.2: Head decoration protein D (gpD, major capsid protein D) [51274] (1 family) (S)
    automatically mapped to Pfam PF02924
  5. 1560575Family b.85.2.1: Head decoration protein D (gpD, major capsid protein D) [51275] (2 proteins)
  6. 1560576Protein Head decoration protein D (gpD, major capsid protein D) [51276] (2 species)
  7. 1560587Species Bacteriophage P21 [TaxId:10711] [117332] (3 PDB entries)
    Uniprot P36275
  8. 1560590Domain d1td0b_: 1td0 B: [112383]

Details for d1td0b_

PDB Entry: 1td0 (more details), 1.95 Å

PDB Description: Viral capsid protein SHP at pH 5.5
PDB Compounds: (B:) Head decoration protein

SCOPe Domain Sequences for d1td0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1td0b_ b.85.2.1 (B:) Head decoration protein D (gpD, major capsid protein D) {Bacteriophage P21 [TaxId: 10711]}
evrifagndpahtatgssgissptpaltplmldeatgklvvwdgqkagsavgilvlpleg
tetaltyyksgtfateaihwpesvdehkkanafagsalshaa

SCOPe Domain Coordinates for d1td0b_:

Click to download the PDB-style file with coordinates for d1td0b_.
(The format of our PDB-style files is described here.)

Timeline for d1td0b_: