Lineage for d1td0b_ (1td0 B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 568126Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 568178Superfamily b.85.2: Head decoration protein D (gpD, major capsid protein D) [51274] (1 family) (S)
  5. 568179Family b.85.2.1: Head decoration protein D (gpD, major capsid protein D) [51275] (1 protein)
  6. 568180Protein Head decoration protein D (gpD, major capsid protein D) [51276] (2 species)
  7. 568191Species Bacteriophage P21 [TaxId:10711] [117332] (3 PDB entries)
  8. 568194Domain d1td0b_: 1td0 B: [112383]

Details for d1td0b_

PDB Entry: 1td0 (more details), 1.95 Å

PDB Description: Viral capsid protein SHP at pH 5.5

SCOP Domain Sequences for d1td0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1td0b_ b.85.2.1 (B:) Head decoration protein D (gpD, major capsid protein D) {Bacteriophage P21}
evrifagndpahtatgssgissptpaltplmldeatgklvvwdgqkagsavgilvlpleg
tetaltyyksgtfateaihwpesvdehkkanafagsalshaa

SCOP Domain Coordinates for d1td0b_:

Click to download the PDB-style file with coordinates for d1td0b_.
(The format of our PDB-style files is described here.)

Timeline for d1td0b_: