Lineage for d1ta8a_ (1ta8 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2541368Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2541972Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) (S)
    has a circularly permuted topology
  5. 2541988Family d.142.2.2: Adenylation domain of NAD+-dependent DNA ligase [56096] (2 proteins)
    automatically mapped to Pfam PF01653
  6. 2541989Protein Adenylation domain of NAD+-dependent DNA ligase [56097] (4 species)
    contains additional, N-terminal all-alpha subdomain
  7. 2541993Species Enterococcus faecalis [TaxId:1351] [118124] (9 PDB entries)
    Uniprot Q837V6 5-317
  8. 2541994Domain d1ta8a_: 1ta8 A: [112375]
    complexed with gol, nmn, so4

Details for d1ta8a_

PDB Entry: 1ta8 (more details), 1.8 Å

PDB Description: structural rearrangement accompanying nad+ synthesis within a bacterial dna ligase crystal
PDB Compounds: (A:) DNA ligase, NAD-dependent

SCOPe Domain Sequences for d1ta8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ta8a_ d.142.2.2 (A:) Adenylation domain of NAD+-dependent DNA ligase {Enterococcus faecalis [TaxId: 1351]}
pltltaattraqelrkqlnqysheyyvkdqpsvedyvydrlykelvdietefpdlitpds
ptqrvggkvlsgfekaphdipmyslndgfskedifafdervrkaigkpvayccelkidgl
aislryengvfvrgatrgdgtvgenitenlrtvrsvpmrltepisvevrgecympkqsfv
alneereengqdifanprnaaagslrqldtkivakrnlntflytvadfgpmkaktqfeal
eelsaigfrtnperqlcqsidevwayieeyhekrstlpyeidgivikvnefalqdelgft
vkaprwaiaykfp

SCOPe Domain Coordinates for d1ta8a_:

Click to download the PDB-style file with coordinates for d1ta8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ta8a_: