Lineage for d1t9qa_ (1t9q A:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 624613Fold g.41: Rubredoxin-like [57769] (14 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 624740Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 624741Family g.41.5.1: Rubredoxin [57803] (3 proteins)
  6. 624742Protein Rubredoxin [57804] (6 species)
  7. 624755Species Clostridium pasteurianum [TaxId:1501] [57808] (23 PDB entries)
  8. 624783Domain d1t9qa_: 1t9q A: [112372]
    complexed with fe; mutant

Details for d1t9qa_

PDB Entry: 1t9q (more details), 1.8 Å

PDB Description: crystal structure of v44l cp rubredoxin

SCOP Domain Sequences for d1t9qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t9qa_ g.41.5.1 (A:) Rubredoxin {Clostridium pasteurianum}
mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplcglgkdqfeeve

SCOP Domain Coordinates for d1t9qa_:

Click to download the PDB-style file with coordinates for d1t9qa_.
(The format of our PDB-style files is described here.)

Timeline for d1t9qa_: