SCOPe 2.08: Domain d1t9ma_: 1t9m A:

Lineage for d1t9ma_ (1t9m A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)

6. Protein Pyridoxine 5'-phoshate oxidase (PNP oxidase) [50479] (6 species)
   elaborated with additional secondary structures; active as dimer

7. Species Pseudomonas aeruginosa [TaxId:287] [117226] (1 PDB entry)
   Uniprot Q820A5

8. Domain d1t9ma_: 1t9m A: [112364]
   complexed with acy, fmn, so4
   has additional insertions and/or extensions that are not grouped together

Details for d1t9ma_

PDB Entry: 1t9m, 1.9 Å

PDB Description: X-ray crystal structure of phzG from pseudomonas aeruginosa

PDB Compounds: (A:) probable pyridoxamine 5'-phosphate oxidase

SCOPe Domain Sequences for d1t9ma_:

Sequence; same for both SEQRES and ATOM records:

>d1t9ma_ b.45.1.1 (A:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Pseudomonas aeruginosa [TaxId: 287]}
ltgtieapfpefeappanpmevlrnwlerarrygvrepralalatvdgqgrpstrivvia
elgergvvfathadsqkgrelaqnpwasgvlywressqqiilngraerlpderadaqwls
rpyqthpmsiasrqsetladihalraearrlaetdgplprppgyclfelclesvefwgng
terlherlrydrdeggwkhrylqp

Timeline for d1t9ma_:

• d1t9ma_ first appeared in SCOP 1.71
  
• d1t9ma_ appears in SCOPe 2.07