SCOPe 2.05: Domain d1t9jb_: 1t9j B:

Lineage for d1t9jb_ (1t9j B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
   alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243

4. Superfamily d.95.2: Homing endonucleases [55608] (3 families)

5. Family d.95.2.1: Group I mobile intron endonuclease [55609] (6 proteins)
   contains two extra helices in the C-terminal extension

6. Protein DNA endonuclease I-CreI [55610] (1 species)

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [55611] (11 PDB entries)
   Uniprot P05725 2-154 ! Uniprot P05725

8. Domain d1t9jb_: 1t9j B: [112363]
   protein/DNA complex

Details for d1t9jb_

PDB Entry: 1t9j, 2 Å

PDB Description: i-crei(q47e)/dna complex

PDB Compounds: (B:) DNA endonuclease I-crei

SCOPe Domain Sequences for d1t9jb_:

Sequence; same for both SEQRES and ATOM records:

>d1t9jb_ d.95.2.1 (B:) DNA endonuclease I-CreI {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
tkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtektqrrwfldklvdei
gvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdkf
levctwvdqiaalndsktrkttsetvravld

Timeline for d1t9jb_:

• d1t9jb_ first appeared in SCOP 1.71
  
• d1t9jb_ appears in SCOPe 2.04
  
• d1t9jb_ appears in SCOPe 2.06
  
• d1t9jb_ appears in the current release, SCOPe 2.08