Lineage for d1t9ja_ (1t9j A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2531154Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 2531165Superfamily d.95.2: Homing endonucleases [55608] (3 families) (S)
  5. 2531166Family d.95.2.1: Group I mobile intron endonuclease [55609] (6 proteins)
    contains two extra helices in the C-terminal extension
  6. 2531173Protein DNA endonuclease I-CreI [55610] (1 species)
  7. 2531174Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [55611] (11 PDB entries)
    Uniprot P05725 2-154 ! Uniprot P05725
  8. 2531183Domain d1t9ja_: 1t9j A: [112362]
    protein/DNA complex

Details for d1t9ja_

PDB Entry: 1t9j (more details), 2 Å

PDB Description: i-crei(q47e)/dna complex
PDB Compounds: (A:) DNA endonuclease I-crei

SCOPe Domain Sequences for d1t9ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t9ja_ d.95.2.1 (A:) DNA endonuclease I-CreI {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
tkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtektqrrwfldklvdei
gvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdkf
levctwvdqiaalndsktrkttsetvravld

SCOPe Domain Coordinates for d1t9ja_:

Click to download the PDB-style file with coordinates for d1t9ja_.
(The format of our PDB-style files is described here.)

Timeline for d1t9ja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1t9jb_