Lineage for d1t9ib_ (1t9i B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 608385Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 608392Superfamily d.95.2: Homing endonucleases [55608] (2 families) (S)
  5. 608393Family d.95.2.1: Group I mobile intron endonuclease [55609] (5 proteins)
    contains two extra helices in the C-terminal extension
  6. 608398Protein DNA endonuclease I-CreI [55610] (1 species)
  7. 608399Species Chlamydomonas reinhardtii [TaxId:3055] [55611] (11 PDB entries)
  8. 608401Domain d1t9ib_: 1t9i B: [112361]
    complexed with ca, na; mutant

Details for d1t9ib_

PDB Entry: 1t9i (more details), 1.6 Å

PDB Description: i-crei(d20n)/dna complex

SCOP Domain Sequences for d1t9ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t9ib_ d.95.2.1 (B:) DNA endonuclease I-CreI {Chlamydomonas reinhardtii}
ntkynkefllylagfvdgngsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvde
igvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
flevctwvdqiaalndsktrkttsetvravldsls

SCOP Domain Coordinates for d1t9ib_:

Click to download the PDB-style file with coordinates for d1t9ib_.
(The format of our PDB-style files is described here.)

Timeline for d1t9ib_: