Lineage for d1t9ia_ (1t9i A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730086Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 730093Superfamily d.95.2: Homing endonucleases [55608] (2 families) (S)
  5. 730094Family d.95.2.1: Group I mobile intron endonuclease [55609] (5 proteins)
    contains two extra helices in the C-terminal extension
  6. 730099Protein DNA endonuclease I-CreI [55610] (1 species)
  7. 730100Species Chlamydomonas reinhardtii [TaxId:3055] [55611] (11 PDB entries)
  8. 730101Domain d1t9ia_: 1t9i A: [112360]

Details for d1t9ia_

PDB Entry: 1t9i (more details), 1.6 Å

PDB Description: i-crei(d20n)/dna complex
PDB Compounds: (A:) DNA endonuclease I-crei

SCOP Domain Sequences for d1t9ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t9ia_ d.95.2.1 (A:) DNA endonuclease I-CreI {Chlamydomonas reinhardtii [TaxId: 3055]}
ntkynkefllylagfvdgngsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvde
igvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
flevctwvdqiaalndsktrkttsetvravlds

SCOP Domain Coordinates for d1t9ia_:

Click to download the PDB-style file with coordinates for d1t9ia_.
(The format of our PDB-style files is described here.)

Timeline for d1t9ia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1t9ib_