Lineage for d1t9ha2 (1t9h A:68-298)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2475515Protein Probable GTPase EngC (YjeQ), C-terminal domain [110542] (2 species)
    circularly permuted G-domain similar to B. sutilis YlqF; distinct extra C-terminal all-alpha subdomain
  7. 2475516Species Bacillus subtilis [TaxId:1423] [117534] (1 PDB entry)
    Uniprot O34530
  8. 2475517Domain d1t9ha2: 1t9h A:68-298 [112359]
    Other proteins in same PDB: d1t9ha1, d1t9ha3
    complexed with act, ca, ium, zn

Details for d1t9ha2

PDB Entry: 1t9h (more details), 1.6 Å

PDB Description: The crystal structure of YloQ, a circularly permuted GTPase.
PDB Compounds: (A:) Probable GTPase engC

SCOPe Domain Sequences for d1t9ha2:

Sequence, based on SEQRES records: (download)

>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]}
nelirppicnvdqavlvfsavqpsfstalldrflvlveandiqpiicitkmdliedqdte
dtiqayaedyrnigydvyltsskdqdsladiiphfqdkttvfagqsgvgkssllnaispe
lglrtneisehlgrgkhttrhvelihtsgglvadtpgfssleftdieeeelgytfpdire
ksssckfrgclhlkepkcavkqavedgelkqyrydhyvefmteikdrkpry

Sequence, based on observed residues (ATOM records): (download)

>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]}
nelirppicnvdqavlvfsavqpsfstalldrflvlveandiqpiicitkmdliedqdte
dtiqayaedyrnigydvyltsskdqdsladiiphfqdkttvfagqsgvgkssllnaispt
rhvelihtsgglvadtpgfssleftdieeeelgytfpdireksssckfrgclhlkepkca
vkqavedgelkqyrydhyvefmteikdrkpry

SCOPe Domain Coordinates for d1t9ha2:

Click to download the PDB-style file with coordinates for d1t9ha2.
(The format of our PDB-style files is described here.)

Timeline for d1t9ha2: