Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (80 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Probable GTPase EngC (YjeQ), C-terminal domain [110542] (2 species) circularly permuted G-domain similar to B. sutilis YlqF; distinct extra C-terminal all-alpha subdomain |
Species Bacillus subtilis [TaxId:1423] [117534] (1 PDB entry) Uniprot O34530 |
Domain d1t9ha2: 1t9h A:68-298 [112359] Other proteins in same PDB: d1t9ha1, d1t9ha3 complexed with act, ca, ium, zn |
PDB Entry: 1t9h (more details), 1.6 Å
SCOPe Domain Sequences for d1t9ha2:
Sequence, based on SEQRES records: (download)
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} nelirppicnvdqavlvfsavqpsfstalldrflvlveandiqpiicitkmdliedqdte dtiqayaedyrnigydvyltsskdqdsladiiphfqdkttvfagqsgvgkssllnaispe lglrtneisehlgrgkhttrhvelihtsgglvadtpgfssleftdieeeelgytfpdire ksssckfrgclhlkepkcavkqavedgelkqyrydhyvefmteikdrkpry
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} nelirppicnvdqavlvfsavqpsfstalldrflvlveandiqpiicitkmdliedqdte dtiqayaedyrnigydvyltsskdqdsladiiphfqdkttvfagqsgvgkssllnaispt rhvelihtsgglvadtpgfssleftdieeeelgytfpdireksssckfrgclhlkepkca vkqavedgelkqyrydhyvefmteikdrkpry
Timeline for d1t9ha2: