![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (45 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Probable GTPase EngC (YjeQ), C-terminal domain [110542] (2 species) circularly permuted G-domain similar to B. sutilis YlqF; distinct extra C-terminal all-alpha subdomain |
![]() | Species Bacillus subtilis [TaxId:1423] [117534] (1 PDB entry) |
![]() | Domain d1t9ha2: 1t9h A:68-298 [112359] Other proteins in same PDB: d1t9ha1 complexed with act, ca, ium, zn |
PDB Entry: 1t9h (more details), 1.6 Å
SCOP Domain Sequences for d1t9ha2:
Sequence, based on SEQRES records: (download)
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis} nelirppicnvdqavlvfsavqpsfstalldrflvlveandiqpiicitkmdliedqdte dtiqayaedyrnigydvyltsskdqdsladiiphfqdkttvfagqsgvgkssllnaispe lglrtneisehlgrgkhttrhvelihtsgglvadtpgfssleftdieeeelgytfpdire ksssckfrgclhlkepkcavkqavedgelkqyrydhyvefmteikdrkpry
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis} nelirppicnvdqavlvfsavqpsfstalldrflvlveandiqpiicitkmdliedqdte dtiqayaedyrnigydvyltsskdqdsladiiphfqdkttvfagqsgvgkssllnaispt rhvelihtsgglvadtpgfssleftdieeeelgytfpdireksssckfrgclhlkepkca vkqavedgelkqyrydhyvefmteikdrkpry
Timeline for d1t9ha2: