Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology |
Protein Acetohydroxyacid synthase catalytic subunit [88758] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88759] (6 PDB entries) Uniprot P07342 84-687 |
Domain d1t9dd3: 1t9d D:461-687 [112357] Other proteins in same PDB: d1t9da1, d1t9da2, d1t9db1, d1t9db2, d1t9dc1, d1t9dc2, d1t9dd1, d1t9dd2 complexed with 1mm, fad, k, mg, p22, p25, pyd |
PDB Entry: 1t9d (more details), 2.3 Å
SCOPe Domain Sequences for d1t9dd3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t9dd3 c.36.1.9 (D:461-687) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} aymeetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhwtwrnphtfitsg glgtmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagtpvkililnneeq gmvtqwqslfyehryshthqlnpdfiklaeamglkglrvkkqeeldaklkefvstkgpvl levevdkkvpvlpmvaggsgldefinfdpeverqqtelrhkrtggkh
Timeline for d1t9dd3: