![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (7 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology |
![]() | Protein Acetohydroxyacid synthase catalytic subunit [88733] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88734] (6 PDB entries) |
![]() | Domain d1t9dd2: 1t9d D:89-263 [112356] Other proteins in same PDB: d1t9da1, d1t9da3, d1t9db1, d1t9db3, d1t9dc1, d1t9dc3, d1t9dd1, d1t9dd3 complexed with 1mm, fad, k, mg, p22, p25, yf1 |
PDB Entry: 1t9d (more details), 2.3 Å
SCOP Domain Sequences for d1t9dd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t9dd2 c.36.1.5 (D:89-263) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae)} fvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdkfnfvlpkheqgaghmaeg yarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgqvptsaigtdafqeadvvg isrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlpkdvtaailrnpip
Timeline for d1t9dd2: