Lineage for d1t9dc2 (1t9d C:89-263)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 694610Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 694611Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 694612Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
  6. 694613Protein Acetohydroxyacid synthase catalytic subunit [88733] (2 species)
  7. 694614Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88734] (6 PDB entries)
  8. 694619Domain d1t9dc2: 1t9d C:89-263 [112353]
    Other proteins in same PDB: d1t9da1, d1t9da3, d1t9db1, d1t9db3, d1t9dc1, d1t9dc3, d1t9dd1, d1t9dd3

Details for d1t9dc2

PDB Entry: 1t9d (more details), 2.3 Å

PDB Description: crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl
PDB Compounds: (C:) Acetolactate synthase, mitochondrial

SCOP Domain Sequences for d1t9dc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t9dc2 c.36.1.5 (C:89-263) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdkfnfvlpkheqgaghmaeg
yarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgqvptsaigtdafqeadvvg
isrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlpkdvtaailrnpip

SCOP Domain Coordinates for d1t9dc2:

Click to download the PDB-style file with coordinates for d1t9dc2.
(The format of our PDB-style files is described here.)

Timeline for d1t9dc2: