| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
| Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins) N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold |
| Protein Acetohydroxyacid synthase catalytic subunit [69463] (2 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69464] (6 PDB entries) Uniprot P07342 84-687 |
| Domain d1t9dc1: 1t9d C:290-460 [112352] Other proteins in same PDB: d1t9da2, d1t9da3, d1t9db2, d1t9db3, d1t9dc2, d1t9dc3, d1t9dd2, d1t9dd3 complexed with 1mm, fad, k, mg, p22, p25, pyd |
PDB Entry: 1t9d (more details), 2.3 Å
SCOPe Domain Sequences for d1t9dc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t9dc1 c.31.1.3 (C:290-460) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nkaadlinlakkpvlyvgagilnhadgprllkelsdraqipvtttlqglgsfdqedpksl
dmlgmhgcatanlavqnadliiavgarfddrvtgniskfapearraaaegrggiihfevs
pkninkvvqtqiavegdattnlgkmmskifpvkersewfaqinkwkkeypy
Timeline for d1t9dc1: