SCOP 1.71: Domain d1t9da2: 1t9d A:89-263

Lineage for d1t9da2 (1t9d A:89-263)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (7 proteins)
   the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology

6. Protein Acetohydroxyacid synthase catalytic subunit [88733] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88734] (6 PDB entries)

8. Domain d1t9da2: 1t9d A:89-263 [112347]
   Other proteins in same PDB: d1t9da1, d1t9da3, d1t9db1, d1t9db3, d1t9dc1, d1t9dc3, d1t9dd1, d1t9dd3

Details for d1t9da2

PDB Entry: 1t9d, 2.3 Å

PDB Description: crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl

SCOP Domain Sequences for d1t9da2:

Sequence; same for both SEQRES and ATOM records:

>d1t9da2 c.36.1.5 (A:89-263) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae)}
fvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdkfnfvlpkheqgaghmaeg
yarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgqvptsaigtdafqeadvvg
isrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlpkdvtaailrnpip

Timeline for d1t9da2:

• d1t9da2 is new in SCOP 1.71
  
• d1t9da2 appears in SCOP 1.73
  
• d1t9da2 appears in the current release, SCOPe 2.08