Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) binds cofactor molecules in the opposite direction than classical Rossmann fold |
Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins) N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold |
Protein Acetohydroxyacid synthase catalytic subunit [69463] (3 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69464] (8 PDB entries) Uniprot P07342 84-687 |
Domain d1t9cb1: 1t9c B:281-460 [112343] Other proteins in same PDB: d1t9ca2, d1t9ca3, d1t9cb2, d1t9cb3 complexed with 1sm, fad, k, mg, p22, p23 |
PDB Entry: 1t9c (more details), 2.34 Å
SCOPe Domain Sequences for d1t9cb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t9cb1 c.31.1.3 (B:281-460) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} qdefvmqsinkaadlinlakkpvlyvgagilnhadgprllkelsdraqipvtttlqglgs fdqedpksldmlgmhgcatanlavqnadliiavgarfddrvtgniskfapearraaaegr ggiihfevspkninkvvqtqiavegdattnlgkmmskifpvkersewfaqinkwkkeypy
Timeline for d1t9cb1: