SCOPe 2.08: Domain d1t9ca2: 1t9c A:89-263

Lineage for d1t9ca2 (1t9c A:89-263)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
   the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
   automatically mapped to Pfam PF02776

6. Protein Acetohydroxyacid synthase catalytic subunit [88733] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88734] (8 PDB entries)
   Uniprot P07342 84-687

8. Domain d1t9ca2: 1t9c A:89-263 [112341]
   Other proteins in same PDB: d1t9ca1, d1t9ca3, d1t9cb1, d1t9cb3
   complexed with 1sm, fad, k, mg, p22, p23

Details for d1t9ca2

PDB Entry: 1t9c, 2.34 Å

PDB Description: crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl

PDB Compounds: (A:) Acetolactate synthase, mitochondrial

SCOPe Domain Sequences for d1t9ca2:

Sequence; same for both SEQRES and ATOM records:

>d1t9ca2 c.36.1.5 (A:89-263) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdkfnfvlpkheqgaghmaeg
yarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgqvptsaigtdafqeadvvg
isrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlpkdvtaailrnpip

Timeline for d1t9ca2:

• d1t9ca2 first appeared in SCOP 1.71
  
• d1t9ca2 appears in SCOPe 2.07