Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families) binds cofactor molecules in the opposite direction than classical Rossmann fold |
Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (7 proteins) N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold |
Protein Acetohydroxyacid synthase catalytic subunit [69463] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69464] (6 PDB entries) |
Domain d1t9ca1: 1t9c A:290-460 [112340] Other proteins in same PDB: d1t9ca2, d1t9ca3, d1t9cb2, d1t9cb3 |
PDB Entry: 1t9c (more details), 2.34 Å
SCOP Domain Sequences for d1t9ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t9ca1 c.31.1.3 (A:290-460) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae)} nkaadlinlakkpvlyvgagilnhadgprllkelsdraqipvtttlqglgsfdqedpksl dmlgmhgcatanlavqnadliiavgarfddrvtgniskfapearraaaegrggiihfevs pkninkvvqtqiavegdattnlgkmmskifpvkersewfaqinkwkkeypy
Timeline for d1t9ca1: