![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology |
![]() | Protein Acetohydroxyacid synthase catalytic subunit [88758] (3 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88759] (8 PDB entries) Uniprot P07342 84-687 |
![]() | Domain d1t9ba3: 1t9b A:461-687 [112336] Other proteins in same PDB: d1t9ba1, d1t9ba2, d1t9bb1, d1t9bb2 complexed with 1cs, fad, k, mg, nsp, p22, p25, yf3 |
PDB Entry: 1t9b (more details), 2.2 Å
SCOPe Domain Sequences for d1t9ba3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t9ba3 c.36.1.9 (A:461-687) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} aymeetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhwtwrnphtfitsg glgtmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagtpvkililnneeq gmvtqwqslfyehryshthqlnpdfiklaeamglkglrvkkqeeldaklkefvstkgpvl levevdkkvpvlpmvaggsgldefinfdpeverqqtelrhkrtggkh
Timeline for d1t9ba3: