Lineage for d1t9ab3 (1t9a B:461-687)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 694610Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 694611Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 694852Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology
  6. 694853Protein Acetohydroxyacid synthase catalytic subunit [88758] (2 species)
  7. 694854Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88759] (6 PDB entries)
  8. 694864Domain d1t9ab3: 1t9a B:461-687 [112333]
    Other proteins in same PDB: d1t9aa1, d1t9aa2, d1t9ab1, d1t9ab2
    complexed with 1tb, fad, k, mg, p23, yf3, yf4

Details for d1t9ab3

PDB Entry: 1t9a (more details), 2.59 Å

PDB Description: crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl
PDB Compounds: (B:) Acetolactate synthase, mitochondrial

SCOP Domain Sequences for d1t9ab3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t9ab3 c.36.1.9 (B:461-687) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aymeetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhwtwrnphtfitsg
glgtmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagtpvkililnneeq
gmvtqwqslfyehryshthqlnpdfiklaeamglkglrvkkqeeldaklkefvstkgpvl
levevdkkvpvlpmvaggsgldefinfdpeverqqtelrhkrtggkh

SCOP Domain Coordinates for d1t9ab3:

Click to download the PDB-style file with coordinates for d1t9ab3.
(The format of our PDB-style files is described here.)

Timeline for d1t9ab3: