Lineage for d1t92b1 (1t92 B:26-132)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941191Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 2941192Superfamily d.24.1: Pili subunits [54523] (8 families) (S)
    bacterial filament proteins
  5. 2941237Family d.24.1.3: Pseudopilin [117865] (2 proteins)
    automatically mapped to Pfam PF08334
  6. 2941238Protein Pullulanase secretion protein PulG [117866] (1 species)
  7. 2941239Species Klebsiella pneumoniae [TaxId:573] [117867] (1 PDB entry)
    Uniprot P15746 32-138
  8. 2941241Domain d1t92b1: 1t92 B:26-132 [112327]
    Other proteins in same PDB: d1t92a2, d1t92b2
    complexed with zn

Details for d1t92b1

PDB Entry: 1t92 (more details), 1.6 Å

PDB Description: crystal structure of n-terminal truncated pseudopilin pulg
PDB Compounds: (B:) General secretion pathway protein G

SCOPe Domain Sequences for d1t92b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t92b1 d.24.1.3 (B:26-132) Pullulanase secretion protein PulG {Klebsiella pneumoniae [TaxId: 573]}
gnkekadrqkvvsdlvalegaldmykldnsryptteqglqalvsapsaepharnypeggy
irrlpqdpwgsdyqllspgqhgqvdifslgpdgvpesnddignwtig

SCOPe Domain Coordinates for d1t92b1:

Click to download the PDB-style file with coordinates for d1t92b1.
(The format of our PDB-style files is described here.)

Timeline for d1t92b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t92b2