SCOPe 2.06: Domain d1t92a1: 1t92 A:26-132

Lineage for d1t92a1 (1t92 A:26-132)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.24: Pili subunits [54522] (1 superfamily)
   contains very long N-terminal helix, which end is packed against beta-sheet

4. Superfamily d.24.1: Pili subunits [54523] (8 families)
   bacterial filament proteins

5. Family d.24.1.3: Pseudopilin [117865] (2 proteins)
   automatically mapped to Pfam PF08334

6. Protein Pullulanase secretion protein PulG [117866] (1 species)

7. Species Klebsiella pneumoniae [TaxId:573] [117867] (1 PDB entry)
   Uniprot P15746 32-138

8. Domain d1t92a1: 1t92 A:26-132 [112326]
   Other proteins in same PDB: d1t92a2, d1t92b2
   complexed with zn

Details for d1t92a1

PDB Entry: 1t92, 1.6 Å

PDB Description: crystal structure of n-terminal truncated pseudopilin pulg

PDB Compounds: (A:) General secretion pathway protein G

SCOPe Domain Sequences for d1t92a1:

Sequence; same for both SEQRES and ATOM records:

>d1t92a1 d.24.1.3 (A:26-132) Pullulanase secretion protein PulG {Klebsiella pneumoniae [TaxId: 573]}
gnkekadrqkvvsdlvalegaldmykldnsryptteqglqalvsapsaepharnypeggy
irrlpqdpwgsdyqllspgqhgqvdifslgpdgvpesnddignwtig

Timeline for d1t92a1:

• d1t92a1 first appeared in SCOP 1.71, called d1t92a_
  
• d1t92a1 was called d1t92a_ in SCOPe 2.05
  
• d1t92a1 appears in SCOPe 2.07
  
• d1t92a1 appears in the current release, SCOPe 2.08