| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.24: Pili subunits [54522] (1 superfamily) contains very long N-terminal helix, which end is packed against beta-sheet |
Superfamily d.24.1: Pili subunits [54523] (8 families) ![]() bacterial filament proteins |
| Family d.24.1.3: Pseudopilin [117865] (2 proteins) automatically mapped to Pfam PF08334 |
| Protein Pullulanase secretion protein PulG [117866] (1 species) |
| Species Klebsiella pneumoniae [TaxId:573] [117867] (1 PDB entry) Uniprot P15746 32-138 |
| Domain d1t92a_: 1t92 A: [112326] complexed with zn |
PDB Entry: 1t92 (more details), 1.6 Å
SCOPe Domain Sequences for d1t92a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t92a_ d.24.1.3 (A:) Pullulanase secretion protein PulG {Klebsiella pneumoniae [TaxId: 573]}
gnkekadrqkvvsdlvalegaldmykldnsryptteqglqalvsapsaepharnypeggy
irrlpqdpwgsdyqllspgqhgqvdifslgpdgvpesnddignwtigf
Timeline for d1t92a_: