Lineage for d1t92a_ (1t92 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1899788Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 1899789Superfamily d.24.1: Pili subunits [54523] (8 families) (S)
    bacterial filament proteins
  5. 1899834Family d.24.1.3: Pseudopilin [117865] (2 proteins)
    automatically mapped to Pfam PF08334
  6. 1899835Protein Pullulanase secretion protein PulG [117866] (1 species)
  7. 1899836Species Klebsiella pneumoniae [TaxId:573] [117867] (1 PDB entry)
    Uniprot P15746 32-138
  8. 1899837Domain d1t92a_: 1t92 A: [112326]
    complexed with zn

Details for d1t92a_

PDB Entry: 1t92 (more details), 1.6 Å

PDB Description: crystal structure of n-terminal truncated pseudopilin pulg
PDB Compounds: (A:) General secretion pathway protein G

SCOPe Domain Sequences for d1t92a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t92a_ d.24.1.3 (A:) Pullulanase secretion protein PulG {Klebsiella pneumoniae [TaxId: 573]}
gnkekadrqkvvsdlvalegaldmykldnsryptteqglqalvsapsaepharnypeggy
irrlpqdpwgsdyqllspgqhgqvdifslgpdgvpesnddignwtigf

SCOPe Domain Coordinates for d1t92a_:

Click to download the PDB-style file with coordinates for d1t92a_.
(The format of our PDB-style files is described here.)

Timeline for d1t92a_: