Lineage for d1t8ga_ (1t8g A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 595959Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 595960Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 596519Family d.2.1.3: Phage lysozyme [53981] (3 proteins)
  6. 596525Protein Phage T4 lysozyme [53982] (1 species)
  7. 596526Species Bacteriophage T4 [TaxId:10665] [53983] (405 PDB entries)
    many mutant structures
  8. 596622Domain d1t8ga_: 1t8g A: [112320]
    complexed with bme, cl, po4; mutant

Details for d1t8ga_

PDB Entry: 1t8g (more details), 1.8 Å

PDB Description: crystal structure of phage t4 lysozyme mutant l32a/l33a/t34a/c54t/c97a/e108v

SCOP Domain Sequences for d1t8ga_:

Sequence, based on SEQRES records: (download)

>d1t8ga_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4}
mnifemlrideglrlkiykdtegyytigighaatkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgvtgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

Sequence, based on observed residues (ATOM records): (download)

>d1t8ga_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4}
mnifemlrideglrlkiykdtegyytigighaaslnaakseldkaigrntngvitkdeae
klfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgvtgvagftnslrmlqqk
rwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

SCOP Domain Coordinates for d1t8ga_:

Click to download the PDB-style file with coordinates for d1t8ga_.
(The format of our PDB-style files is described here.)

Timeline for d1t8ga_: